- Totalt 0 sek
Anti-TRAIL-R3 (human) Antibody
Lägg till en bevakning så meddelar vi dig så snart varan är i lager igen.
Anti-TRAIL-R3 (human) Antibody
Goat Polyclonal TRAIL-R3 (human) Antibody. Validated in IF, WB and tested in Human. Size: 200µg.
Size: 200ug
Source: Goat
Reactivity: Human
Purity: Epitope-affinity purified IgG.
Application: IF, WB
Immunogen: Synthetic peptide corresponding to aa 33-63 (E33VPQQTVAPQQQRHSFKGEECPAGSHRSEHT63) of the extracellular domain of human TRAIL-R3.
Clonality: Polyclonal
Storage temperature: -20°C
Transport temperature: Shipped with wet ice
Supplier: Bosterbio
Size: 200ug
Source: Goat
Reactivity: Human
Purity: Epitope-affinity purified IgG.
Application: IF, WB
Immunogen: Synthetic peptide corresponding to aa 33-63 (E33VPQQTVAPQQQRHSFKGEECPAGSHRSEHT63) of the extracellular domain of human TRAIL-R3.
Clonality: Polyclonal
Storage temperature: -20°C
Transport temperature: Shipped with wet ice
Supplier: Bosterbio
MSDS skickas på Er begäran.
+46-31-212627

