- Totalt 0 sek
Anti-Toll-like Receptor 4 Antibody
Lägg till en bevakning så meddelar vi dig så snart varan är i lager igen.
Anti-Toll-like Receptor 4 Antibody
Goat Polyclonal Toll-like Receptor 4 Antibody. Validated in IF, IHC and tested in Human, Mouse. Size: 200µg.
Size: 200ug
Source: Goat
Reactivity: Human, Mouse
Purity: Epitope-affinity purified IgG.
Application: IF, IHC
Immunogen: Synthetic peptide corresponding to aa 161-192 (L161IQSFKLPEYFSNLTNLEHLDLSSNKIQSIYC192) of the N-terminal domain of human TLR4 (Toll-like receptor 4) .
Clonality: Polyclonal
Storage temperature: -20°C
Transport temperature: Shipped with wet ice
Supplier: Bosterbio
Size: 200ug
Source: Goat
Reactivity: Human, Mouse
Purity: Epitope-affinity purified IgG.
Application: IF, IHC
Immunogen: Synthetic peptide corresponding to aa 161-192 (L161IQSFKLPEYFSNLTNLEHLDLSSNKIQSIYC192) of the N-terminal domain of human TLR4 (Toll-like receptor 4) .
Clonality: Polyclonal
Storage temperature: -20°C
Transport temperature: Shipped with wet ice
Supplier: Bosterbio
MSDS skickas på Er begäran.
+46-31-212627

