- Totalt 0 sek
Anti-TCP1 alpha Picoband&trade Antibody (monoclonal, 2E7)
![Anti-TCP1 alpha Picoband&trade Antibody (monoclonal, 2E7)](https://cdn.starwebserver.se/img/no-image.png)
Lägg till en bevakning så meddelar vi dig så snart varan är i lager igen.
Anti-TCP1 alpha Picoband&trade Antibody (monoclonal, 2E7)
Mouse Monoclonal TCP1 alpha Antibody (monoclonal, 2E7). Validated in Flow Cytometry, IHC, ICC, WB and tested in Human. Size: 100&mug/vial.
Size: 100ug/vial
Source: Mouse
Reactivity: Human
Application: Flow Cytometry, IHC, ICC, WB
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human TCP1 alpha (515-551aa KFATEAAITILRIDDLIKLHPESKDDKHGSYEDAVHS), different from the related mouse sequence by one amino acid, and from the related rat sequence by two amino acids.
Clonality: Monoclonal
Storage temperature: At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
Transport temperature: Shipped with wet ice
Delivery time: 2-14 days
Supplier: Bosterbio
Size: 100ug/vial
Source: Mouse
Reactivity: Human
Application: Flow Cytometry, IHC, ICC, WB
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human TCP1 alpha (515-551aa KFATEAAITILRIDDLIKLHPESKDDKHGSYEDAVHS), different from the related mouse sequence by one amino acid, and from the related rat sequence by two amino acids.
Clonality: Monoclonal
Storage temperature: At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
Transport temperature: Shipped with wet ice
Delivery time: 2-14 days
Supplier: Bosterbio
MSDS skickas på Er begäran.