- Totalt 0 sek
Anti-SKA2 Picoband&trade Antibody
Lägg till en bevakning så meddelar vi dig så snart varan är i lager igen.
Anti-SKA2 Picoband&trade Antibody
Rabbit IgG polyclonal antibody for SKA2 detection. Tested with WB, FCM in Human.
Size: 100ug/vial
Reactivity: Human
Purity: Immunogen affinity purified.
Application: Flow Cytometry, WB
Immunogen: A synthetic peptide corresponding to a sequence of human SKA2 (EAEVDKLELMFQKAESDLDYIQYRLEYEIK).
Clonality: Polyclonal
Storage temperature: At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
Transport temperature: Shipped with wet ice
Supplier: Bosterbio
Size: 100ug/vial
Reactivity: Human
Purity: Immunogen affinity purified.
Application: Flow Cytometry, WB
Immunogen: A synthetic peptide corresponding to a sequence of human SKA2 (EAEVDKLELMFQKAESDLDYIQYRLEYEIK).
Clonality: Polyclonal
Storage temperature: At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
Transport temperature: Shipped with wet ice
Supplier: Bosterbio
MSDS skickas på Er begäran.
+46-31-212627

