- Totalt 0 sek
Anti-Rel B/RELB Picoband&trade Antibody
Lägg till en bevakning så meddelar vi dig så snart varan är i lager igen.
Anti-Rel B/RELB Picoband&trade Antibody
Polyclonal antibody for RELB detection. Host: Rabbit.Size: 100g/vial. Tested applications: WB. Reactive species: Human. RELB information: Molecular Weight: 62134 MW Subcellular Localization: Nucleus . Cytoplasm, cytoskeleton, microtubule organizing center, centrosome . Colocalizes with NEK6 in the centrosome.
Size: 100ug/vial
Source: Rabbit
Reactivity: Human, Mouse
Purity: Immunogen affinity purified.
Application: Flow Cytometry, WB
Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human Rel B (219-252aa RHSFNNLGIQCVRKKEIEAAIERKIQLGIDPYNA), identical to the related mouse sequence.
Clonality: Polyclonal
Storage temperature: At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid repeated freezing and thawing.
Transport temperature: Shipped with wet ice
Delivery time: 2-14 days
Supplier: Bosterbio
Size: 100ug/vial
Source: Rabbit
Reactivity: Human, Mouse
Purity: Immunogen affinity purified.
Application: Flow Cytometry, WB
Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human Rel B (219-252aa RHSFNNLGIQCVRKKEIEAAIERKIQLGIDPYNA), identical to the related mouse sequence.
Clonality: Polyclonal
Storage temperature: At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid repeated freezing and thawing.
Transport temperature: Shipped with wet ice
Delivery time: 2-14 days
Supplier: Bosterbio
MSDS skickas på Er begäran.
+46-31-212627

