- Totalt 0 sek
Anti-MUC3/MUC3A/MUC3B Picoband&trade Antibody
Lägg till en bevakning så meddelar vi dig så snart varan är i lager igen.
Anti-MUC3/MUC3A/MUC3B Picoband&trade Antibody
Polyclonal antibody for MUC3B detection. Host: Rabbit.Size: 100g/vial. Tested applications: WB. Reactive species: Human. MUC3B information: Molecular Weight: 131402 MW Subcellular Localization: Membrane Single-pass membrane protein Tissue Specificity: Fetal and adult small intestine and fetal and adult colon.
Size: 100ug/vial
Source: Rabbit
Reactivity: Human
Purity: Immunogen affinity purified.
Application: WB
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human MUC3 (DLNDNTSQAYRDFNKTFWNQMQKIFADMQGFTFK).
Clonality: Polyclonal
Storage temperature: At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid repeated freezing and thawing.
Transport temperature: Shipped with wet ice
Delivery time: 2-14 days
Supplier: Bosterbio
Size: 100ug/vial
Source: Rabbit
Reactivity: Human
Purity: Immunogen affinity purified.
Application: WB
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human MUC3 (DLNDNTSQAYRDFNKTFWNQMQKIFADMQGFTFK).
Clonality: Polyclonal
Storage temperature: At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid repeated freezing and thawing.
Transport temperature: Shipped with wet ice
Delivery time: 2-14 days
Supplier: Bosterbio
MSDS skickas på Er begäran.
+46-31-212627

