- Totalt 0 sek
Anti-Human Bcl-2 DyLight® 550 conjugated Antibody

Lägg till en bevakning så meddelar vi dig så snart varan är i lager igen.
Anti-Human Bcl-2 DyLight® 550 conjugated Antibody
Rabbit Polyclonal Human Bcl-2 DyLight® 550 conjugated Antibody. Validated in Flow Cytometry and tested in Human. Size: 100ug/vial.
Size: 100ug/vial
Reactivity: Human
Application: Flow Cytometry
Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human Bcl-2 (102-140aa DDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRD), identical to the related mouse and rat sequences.
Clonality: Polyclonal
Storage temperature: At 2-8°C for one year. Protect from light. Do not freeze.
Transport temperature: Shipped with wet ice
Supplier: Bosterbio
Size: 100ug/vial
Reactivity: Human
Application: Flow Cytometry
Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human Bcl-2 (102-140aa DDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRD), identical to the related mouse and rat sequences.
Clonality: Polyclonal
Storage temperature: At 2-8°C for one year. Protect from light. Do not freeze.
Transport temperature: Shipped with wet ice
Supplier: Bosterbio
MSDS skickas på Er begäran.