- Totalt 0 sek
Anti-Cytokeratin 19 Picoband&trade Antibody (monoclonal, 3D4)

Lägg till en bevakning så meddelar vi dig så snart varan är i lager igen.
Anti-Cytokeratin 19 Picoband&trade Antibody (monoclonal, 3D4)
Mouse Monoclonal Cytokeratin 19 Antibody (monoclonal, 3D4). Validated in IF, IHC, WB and tested in Human. Size: 100&mug/vial.
Size: 100ug/vial
Source: Mouse
Reactivity: Human
Application: IF, IHC, WB
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Cytokeratin 19 (334-372aa QLAHIQALISGIEAQLGDVRADSERQNQEYQRLMDIKSR), different from the related mouse and rat sequences by nine amino acids.
Clonality: Monoclonal
Storage temperature: At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
Transport temperature: Shipped with wet ice
Delivery time: 2-14 days
Supplier: Bosterbio
Size: 100ug/vial
Source: Mouse
Reactivity: Human
Application: IF, IHC, WB
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Cytokeratin 19 (334-372aa QLAHIQALISGIEAQLGDVRADSERQNQEYQRLMDIKSR), different from the related mouse and rat sequences by nine amino acids.
Clonality: Monoclonal
Storage temperature: At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
Transport temperature: Shipped with wet ice
Delivery time: 2-14 days
Supplier: Bosterbio
MSDS skickas på Er begäran.