- Totalt 0 sek
Anti-Acetyl Coenzyme A Carboxylase/ACACB Picoband&trade Antibody
![Anti-Acetyl Coenzyme A Carboxylase/ACACB Picoband&trade Antibody](https://cdn.starwebserver.se/img/no-image.png)
Lägg till en bevakning så meddelar vi dig så snart varan är i lager igen.
Anti-Acetyl Coenzyme A Carboxylase/ACACB Picoband&trade Antibody
Rabbit IgG polyclonal antibody for Acetyl Coenzyme A Carboxylase/ACACB detection. Tested with WB, IHC-P, FCM in HumanMouseRat.
Size: 100ug/vial
Reactivity: Human, Mouse, Rat
Purity: Immunogen affinity purified.
Application: Flow Cytometry, IHC-P, WB
Immunogen: A synthetic peptide corresponding to a sequence of human Acetyl Coenzyme A Carboxylase/ACACB (EENPEVAVDCVIYLSQHISPAERAQVVHLLSTMD).
Clonality: Polyclonal
Storage temperature: At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
Transport temperature: Shipped with wet ice
Supplier: Bosterbio
Size: 100ug/vial
Reactivity: Human, Mouse, Rat
Purity: Immunogen affinity purified.
Application: Flow Cytometry, IHC-P, WB
Immunogen: A synthetic peptide corresponding to a sequence of human Acetyl Coenzyme A Carboxylase/ACACB (EENPEVAVDCVIYLSQHISPAERAQVVHLLSTMD).
Clonality: Polyclonal
Storage temperature: At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
Transport temperature: Shipped with wet ice
Supplier: Bosterbio
MSDS skickas på Er begäran.