- Total 0 sek
Anti-SMC3 Picoband&trade Antibody (monoclonal, 4C12)
Watch this product and we will notify you once it is back in stock.
Anti-SMC3 Picoband&trade Antibody (monoclonal, 4C12)
Mouse Monoclonal SMC3 Antibody (monoclonal, 4C12). Validated in IHC, WB and tested in Human, Mouse, Rat. Size: 100&mug/vial.
Size: 100ug/vial
Reactivity: Human, Mouse, Rat
Application: IHC, WB
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human SMC3(1178-1216aa ELLESADKFYGVKFRNKVSHIDVITAEMAKDFVEDDTTH), identical to the related mouse sequence.
Clonality: Monoclonal
Storage temperature: At -20℃ for one year. After reconstitution, at 4℃ for one month. It can also be aliquotted and stored frozen at -20℃ for a longer time. Avoid repeated freezing and thawing.
Transport temperature: Shipped with wet ice
Supplier: Bosterbio
Size: 100ug/vial
Reactivity: Human, Mouse, Rat
Application: IHC, WB
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human SMC3(1178-1216aa ELLESADKFYGVKFRNKVSHIDVITAEMAKDFVEDDTTH), identical to the related mouse sequence.
Clonality: Monoclonal
Storage temperature: At -20℃ for one year. After reconstitution, at 4℃ for one month. It can also be aliquotted and stored frozen at -20℃ for a longer time. Avoid repeated freezing and thawing.
Transport temperature: Shipped with wet ice
Supplier: Bosterbio
MSDS skickas på Er begäran.
+46-31-212627

