Anti-Human ACTN3 DyLight&reg 488 conjugated Antibody

Rabbit Polyclonal Human ACTN3 DyLight® 488 conjugated Antibody. Validated in Flow Cytometry and tested in Human. Size: 100ug/vial.

Size: 100ug/vial
Reactivity: Human
Application: Flow Cytometry
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human ACTN3 (574-617aa EADRERGAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINT K), different from the related mouse sequence by five amino acids.
Clonality: Polyclonal
Storage temperature: At 2-8°C for one year. Protect from light. Do not freeze.
Transport temperature: Shipped with wet ice

Supplier: Bosterbio